EXO1 monoclonal antibody (M02), clone 1H6 Ver mas grande

EXO1 monoclonal antibody (M02), clone 1H6

AB-H00009156-M02

Producto nuevo

EXO1 monoclonal antibody (M02), clone 1H6

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 100 ug
Gene Name EXO1
Gene Alias HEX1|hExoI
Gene Description exonuclease 1
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq ADSLSTTKIKPLGPARASGLSKKPASIQKRKHHNAENKPGLQIKLNELWKNFGFKKDSEKLPPCKKPLSPVRDNIQLTPEAEEDIFNKPECGRVQRAIFQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EXO1 (AAH07491, 747 a.a. ~ 846 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9156
Clone Number 1H6
Iso type IgG1 Kappa

Más información

Mouse monoclonal antibody raised against a partial recombinant EXO1.

Consulta sobre un producto

EXO1 monoclonal antibody (M02), clone 1H6

EXO1 monoclonal antibody (M02), clone 1H6