EXO1 monoclonal antibody (M02), clone 1H6
  • EXO1 monoclonal antibody (M02), clone 1H6

EXO1 monoclonal antibody (M02), clone 1H6

Ref: AB-H00009156-M02
EXO1 monoclonal antibody (M02), clone 1H6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant EXO1.
Información adicional
Size 100 ug
Gene Name EXO1
Gene Alias HEX1|hExoI
Gene Description exonuclease 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq ADSLSTTKIKPLGPARASGLSKKPASIQKRKHHNAENKPGLQIKLNELWKNFGFKKDSEKLPPCKKPLSPVRDNIQLTPEAEEDIFNKPECGRVQRAIFQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EXO1 (AAH07491, 747 a.a. ~ 846 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9156
Clone Number 1H6
Iso type IgG1 Kappa

Enviar uma mensagem


EXO1 monoclonal antibody (M02), clone 1H6

EXO1 monoclonal antibody (M02), clone 1H6