Ver mas grande
ATG12 monoclonal antibody (M03), clone 1F9
AB-H00009140-M03
Producto nuevo
ATG12 monoclonal antibody (M03), clone 1F9
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | ATG12 |
| Gene Alias | APG12|APG12L|FBR93|HAPG12 |
| Gene Description | ATG12 autophagy related 12 homolog (S. cerevisiae) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,S-ELISA,ELISA |
| Immunogen Prot. Seq | MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | ATG12 (AAH12266, 1 a.a. ~ 140 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 9140 |
| Clone Number | 1F9 |
| Iso type | IgG1 Kappa |
Más información
Mouse monoclonal antibody raised against a full-length recombinant ATG12.