ATG12 monoclonal antibody (M03), clone 1F9 View larger

Mouse monoclonal antibody raised against a full-length recombinant ATG12.

AB-H00009140-M03

New product

ATG12 monoclonal antibody (M03), clone 1F9

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name ATG12
Gene Alias APG12|APG12L|FBR93|HAPG12
Gene Description ATG12 autophagy related 12 homolog (S. cerevisiae)
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ATG12 (AAH12266, 1 a.a. ~ 140 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9140
Clone Number 1F9
Iso type IgG1 Kappa

More info

Mouse monoclonal antibody raised against a full-length recombinant ATG12.

Enviar uma mensagem

Mouse monoclonal antibody raised against a full-length recombinant ATG12.

Mouse monoclonal antibody raised against a full-length recombinant ATG12.