FBP2 polyclonal antibody (A01)
  • FBP2 polyclonal antibody (A01)

FBP2 polyclonal antibody (A01)

Ref: AB-H00008789-A01
FBP2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant FBP2.
Información adicional
Size 50 uL
Gene Name FBP2
Gene Alias MGC142192
Gene Description fructose-1,6-bisphosphatase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQAGS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FBP2 (NP_003828, 240 a.a. ~ 339 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8789

Enviar un mensaje


FBP2 polyclonal antibody (A01)

FBP2 polyclonal antibody (A01)