FBP2 polyclonal antibody (A01) View larger

Mouse polyclonal antibody raised against a partial recombinant FBP2.

AB-H00008789-A01

New product

FBP2 polyclonal antibody (A01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 50 uL
Gene Name FBP2
Gene Alias MGC142192
Gene Description fructose-1,6-bisphosphatase 2
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQAGS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FBP2 (NP_003828, 240 a.a. ~ 339 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8789

More info

Mouse polyclonal antibody raised against a partial recombinant FBP2.

Enviar uma mensagem

Mouse polyclonal antibody raised against a partial recombinant FBP2.

Mouse polyclonal antibody raised against a partial recombinant FBP2.