Ver mas grande
CTNNAL1 monoclonal antibody (M06), clone 2A2
AB-H00008727-M06
Producto nuevo
CTNNAL1 monoclonal antibody (M06), clone 2A2
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | CTNNAL1 |
| Gene Alias | CLLP|FLJ08121|alpha-CATU |
| Gene Description | catenin (cadherin-associated protein), alpha-like 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | ELISA |
| Immunogen Prot. Seq | TDCKPNGETDISSISIFTGIKEFKMNIEALRENLYFQSKENLSVTLEVILERMEDFTDSAYTSHEHRERILELSTQARMELQQLISVWIQAQSKKTKSIAEELE |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | CTNNAL1 (NP_003789, 277 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 8727 |
| Clone Number | 2A2 |
| Iso type | IgG2a Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant CTNNAL1.