CTNNAL1 monoclonal antibody (M06), clone 2A2 View larger

Mouse monoclonal antibody raised against a partial recombinant CTNNAL1.

AB-H00008727-M06

New product

CTNNAL1 monoclonal antibody (M06), clone 2A2

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name CTNNAL1
Gene Alias CLLP|FLJ08121|alpha-CATU
Gene Description catenin (cadherin-associated protein), alpha-like 1
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq TDCKPNGETDISSISIFTGIKEFKMNIEALRENLYFQSKENLSVTLEVILERMEDFTDSAYTSHEHRERILELSTQARMELQQLISVWIQAQSKKTKSIAEELE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CTNNAL1 (NP_003789, 277 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8727
Clone Number 2A2
Iso type IgG2a Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant CTNNAL1.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant CTNNAL1.

Mouse monoclonal antibody raised against a partial recombinant CTNNAL1.