Ver mas grande
AKR7A2 MaxPab rabbit polyclonal antibody (D01)
AB-H00008574-D01
Producto nuevo
AKR7A2 MaxPab rabbit polyclonal antibody (D01)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | AKR7A2 |
| Gene Alias | AFAR|AFAR1|AFB1-AR1|AKR7 |
| Gene Description | aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ti,WB-Ce,WB-Tr,IP |
| Immunogen Prot. Seq | MSRPPPPRVASVLGTMEMGRRMDAPASAAAVRAFLERGHTELDTAFMYSDGQSETILGGLGLGLGGGDCRVKIATKANPWDGKSLKPDSVRSQLETSLKRLQCPQVDLFYLHAPDHGTPVEETLHACQRLHQEGKFVELGLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVETELFPCLRHFGLRFYAYNPLAGGLLTGKYKYEDKDGKQPVGRFFGNSWAETYRNRFWKEHHFEAIALVEKALQAAY |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | AKR7A2 (AAH10852.1, 1 a.a. ~ 330 a.a) full-length human protein. |
| Storage Buffer | No additive |
| Gene ID | 8574 |
Más información
Rabbit polyclonal antibody raised against a full-length human AKR7A2 protein.