AKR7A2 MaxPab rabbit polyclonal antibody (D01)
  • AKR7A2 MaxPab rabbit polyclonal antibody (D01)

AKR7A2 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00008574-D01
AKR7A2 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human AKR7A2 protein.
Información adicional
Size 100 uL
Gene Name AKR7A2
Gene Alias AFAR|AFAR1|AFB1-AR1|AKR7
Gene Description aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IP
Immunogen Prot. Seq MSRPPPPRVASVLGTMEMGRRMDAPASAAAVRAFLERGHTELDTAFMYSDGQSETILGGLGLGLGGGDCRVKIATKANPWDGKSLKPDSVRSQLETSLKRLQCPQVDLFYLHAPDHGTPVEETLHACQRLHQEGKFVELGLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVETELFPCLRHFGLRFYAYNPLAGGLLTGKYKYEDKDGKQPVGRFFGNSWAETYRNRFWKEHHFEAIALVEKALQAAY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen AKR7A2 (AAH10852.1, 1 a.a. ~ 330 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 8574

Enviar un mensaje


AKR7A2 MaxPab rabbit polyclonal antibody (D01)

AKR7A2 MaxPab rabbit polyclonal antibody (D01)