AKR7A2 MaxPab rabbit polyclonal antibody (D01) View larger

Rabbit polyclonal antibody raised against a full-length human AKR7A2 protein.

AB-H00008574-D01

New product

AKR7A2 MaxPab rabbit polyclonal antibody (D01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 uL
Gene Name AKR7A2
Gene Alias AFAR|AFAR1|AFB1-AR1|AKR7
Gene Description aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase)
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IP
Immunogen Prot. Seq MSRPPPPRVASVLGTMEMGRRMDAPASAAAVRAFLERGHTELDTAFMYSDGQSETILGGLGLGLGGGDCRVKIATKANPWDGKSLKPDSVRSQLETSLKRLQCPQVDLFYLHAPDHGTPVEETLHACQRLHQEGKFVELGLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVETELFPCLRHFGLRFYAYNPLAGGLLTGKYKYEDKDGKQPVGRFFGNSWAETYRNRFWKEHHFEAIALVEKALQAAY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen AKR7A2 (AAH10852.1, 1 a.a. ~ 330 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 8574

More info

Rabbit polyclonal antibody raised against a full-length human AKR7A2 protein.

Enviar uma mensagem

Rabbit polyclonal antibody raised against a full-length human AKR7A2 protein.

Rabbit polyclonal antibody raised against a full-length human AKR7A2 protein.