Ver mas grande
TCL1A monoclonal antibody (M01), clone 1E8
AB-H00008115-M01
Producto nuevo
TCL1A monoclonal antibody (M01), clone 1E8
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | TCL1A |
| Gene Alias | TCL1 |
| Gene Description | T-cell leukemia/lymphoma 1A |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | S-ELISA,ELISA |
| Immunogen Prot. Seq | PMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | TCL1A (NP_068801.1, 61 a.a. ~ 114 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 8115 |
| Clone Number | 1E8 |
| Iso type | IgG1 Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant TCL1A.