TCL1A monoclonal antibody (M01), clone 1E8 View larger

Mouse monoclonal antibody raised against a partial recombinant TCL1A.

AB-H00008115-M01

New product

TCL1A monoclonal antibody (M01), clone 1E8

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name TCL1A
Gene Alias TCL1
Gene Description T-cell leukemia/lymphoma 1A
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq PMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TCL1A (NP_068801.1, 61 a.a. ~ 114 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8115
Clone Number 1E8
Iso type IgG1 Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant TCL1A.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant TCL1A.

Mouse monoclonal antibody raised against a partial recombinant TCL1A.