XBP1 monoclonal antibody (M05), clone 2D9
  • XBP1 monoclonal antibody (M05), clone 2D9

XBP1 monoclonal antibody (M05), clone 2D9

Ref: AB-H00007494-M05
XBP1 monoclonal antibody (M05), clone 2D9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant XBP1.
Información adicional
Size 100 ug
Gene Name XBP1
Gene Alias TREB5|XBP2
Gene Description X-box binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq THGLVVENQELRQRLGMDALVAEEEAEAKGNEVRPVAGSAESAALRLRAPLQQVQAQLSPLQNISPWILAVLTLQIQSLISCWAFWTTWTQSCSSNALPQSLP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen XBP1 (AAH12841, 123 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7494
Clone Number 2D9
Iso type IgG2a Kappa

Enviar un mensaje


XBP1 monoclonal antibody (M05), clone 2D9

XBP1 monoclonal antibody (M05), clone 2D9