Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
XBP1 monoclonal antibody (M05), clone 2D9
Abnova
XBP1 monoclonal antibody (M05), clone 2D9
Ref: AB-H00007494-M05
XBP1 monoclonal antibody (M05), clone 2D9
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant XBP1.
Información adicional
Size
100 ug
Gene Name
XBP1
Gene Alias
TREB5|XBP2
Gene Description
X-box binding protein 1
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ti,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq
THGLVVENQELRQRLGMDALVAEEEAEAKGNEVRPVAGSAESAALRLRAPLQQVQAQLSPLQNISPWILAVLTLQIQSLISCWAFWTTWTQSCSSNALPQSLP
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
XBP1 (AAH12841, 123 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
7494
Clone Number
2D9
Iso type
IgG2a Kappa
Enviar uma mensagem
XBP1 monoclonal antibody (M05), clone 2D9
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*