UGT2B10 monoclonal antibody (M02), clone 1B5 Ver mas grande

UGT2B10 monoclonal antibody (M02), clone 1B5

AB-H00007365-M02

Producto nuevo

UGT2B10 monoclonal antibody (M02), clone 1B5

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 100 ug
Gene Name UGT2B10
Gene Alias MGC142209
Gene Description UDP glucuronosyltransferase 2 family, polypeptide B10
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LFDPNDSSTLKLEVYPTSLTKTEFENIIMQLVKRLSEIQKDTFWLPFSQEQEILWAINDIIRNFCKDVVSNKKLMKKLQESRFDIVFADAYLPCGELL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UGT2B10 (NP_001066, 62 a.a. ~ 159 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7365
Clone Number 1B5
Iso type IgG1 Kappa

Más información

Mouse monoclonal antibody raised against a partial recombinant UGT2B10.

Consulta sobre un producto

UGT2B10 monoclonal antibody (M02), clone 1B5

UGT2B10 monoclonal antibody (M02), clone 1B5