UGT2B10 monoclonal antibody (M02), clone 1B5 View larger

Mouse monoclonal antibody raised against a partial recombinant UGT2B10.

AB-H00007365-M02

New product

UGT2B10 monoclonal antibody (M02), clone 1B5

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name UGT2B10
Gene Alias MGC142209
Gene Description UDP glucuronosyltransferase 2 family, polypeptide B10
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LFDPNDSSTLKLEVYPTSLTKTEFENIIMQLVKRLSEIQKDTFWLPFSQEQEILWAINDIIRNFCKDVVSNKKLMKKLQESRFDIVFADAYLPCGELL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UGT2B10 (NP_001066, 62 a.a. ~ 159 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7365
Clone Number 1B5
Iso type IgG1 Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant UGT2B10.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant UGT2B10.

Mouse monoclonal antibody raised against a partial recombinant UGT2B10.