TP53BP2 monoclonal antibody (M02A), clone 1A10
  • TP53BP2 monoclonal antibody (M02A), clone 1A10

TP53BP2 monoclonal antibody (M02A), clone 1A10

Ref: AB-H00007159-M02A
TP53BP2 monoclonal antibody (M02A), clone 1A10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TP53BP2.
Información adicional
Size 200 uL
Gene Name TP53BP2
Gene Alias 53BP2|ASPP2|BBP|PPP1R13A|p53BP2
Gene Description tumor protein p53 binding protein, 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PYFGQTNQPPSDIKPDGSSQQLSTVVPSMGTKPKPAGQQPRVLLSPSIPSVGQDQTLSPGSKQESPPAAAVRPFTPQPSKDTLLPPFRKPQTVAASSIYS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TP53BP2 (AAH58918, 511 a.a. ~ 610 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 7159
Clone Number 1A10
Iso type IgG2a Kappa

Enviar un mensaje


TP53BP2 monoclonal antibody (M02A), clone 1A10

TP53BP2 monoclonal antibody (M02A), clone 1A10