View larger
Mouse monoclonal antibody raised against a partial recombinant TP53BP2.
AB-H00007159-M02A
New product
TP53BP2 monoclonal antibody (M02A), clone 1A10
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 200 uL |
| Gene Name | TP53BP2 |
| Gene Alias | 53BP2|ASPP2|BBP|PPP1R13A|p53BP2 |
| Gene Description | tumor protein p53 binding protein, 2 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | PYFGQTNQPPSDIKPDGSSQQLSTVVPSMGTKPKPAGQQPRVLLSPSIPSVGQDQTLSPGSKQESPPAAAVRPFTPQPSKDTLLPPFRKPQTVAASSIYS |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | TP53BP2 (AAH58918, 511 a.a. ~ 610 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In ascites fluid |
| Gene ID | 7159 |
| Clone Number | 1A10 |
| Iso type | IgG2a Kappa |
More info
Mouse monoclonal antibody raised against a partial recombinant TP53BP2.