TARS polyclonal antibody (A01) Ver mas grande

TARS polyclonal antibody (A01)

AB-H00006897-A01

Producto nuevo

TARS polyclonal antibody (A01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 50 uL
Gene Name TARS
Gene Alias MGC9344|ThrRS
Gene Description threonyl-tRNA synthetase
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RAELNPWPEYIYTRLEMYNILKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKTTPYQIACGISQGLADNTVIAKVNNVVWDLDRPLEEDCTLELLK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TARS (NP_689508, 44 a.a. ~ 143 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6897

Más información

Mouse polyclonal antibody raised against a partial recombinant TARS.

Consulta sobre un producto

TARS polyclonal antibody (A01)

TARS polyclonal antibody (A01)