TARS polyclonal antibody (A01)
  • TARS polyclonal antibody (A01)

TARS polyclonal antibody (A01)

Ref: AB-H00006897-A01
TARS polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TARS.
Información adicional
Size 50 uL
Gene Name TARS
Gene Alias MGC9344|ThrRS
Gene Description threonyl-tRNA synthetase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RAELNPWPEYIYTRLEMYNILKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKTTPYQIACGISQGLADNTVIAKVNNVVWDLDRPLEEDCTLELLK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TARS (NP_689508, 44 a.a. ~ 143 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6897

Enviar uma mensagem


TARS polyclonal antibody (A01)

TARS polyclonal antibody (A01)