Ver mas grande
SP3 monoclonal antibody (M09), clone 4E5
AB-H00006670-M09
Producto nuevo
SP3 monoclonal antibody (M09), clone 4E5
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | SP3 |
| Gene Alias | DKFZp686O1631|SPR-2 |
| Gene Description | Sp3 transcription factor |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ti,WB-Re,ELISA,IF |
| Immunogen Prot. Seq | TAGINADGHLINTGQAMDSSDNSERTGERVSPDINETNTDTDLFVPTSSSSQLPVTIDSTGILQQNTNSLTTSSGQVHSSDLQGNYIQSPVSEETQAQNIQVSTAQPVVQHLQLQESQQPTSQAQIVQGITPQTIHGVQASGQN* |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | SP3 (NP_003102, 287 a.a. ~ 430 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 6670 |
| Clone Number | 4E5 |
| Iso type | IgG2a Kappa |
Más información
Mouse monoclonal antibody raised against a full length recombinant SP3.