View larger
Mouse monoclonal antibody raised against a full length recombinant SP3.
AB-H00006670-M09
New product
SP3 monoclonal antibody (M09), clone 4E5
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | SP3 |
| Gene Alias | DKFZp686O1631|SPR-2 |
| Gene Description | Sp3 transcription factor |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ti,WB-Re,ELISA,IF |
| Immunogen Prot. Seq | TAGINADGHLINTGQAMDSSDNSERTGERVSPDINETNTDTDLFVPTSSSSQLPVTIDSTGILQQNTNSLTTSSGQVHSSDLQGNYIQSPVSEETQAQNIQVSTAQPVVQHLQLQESQQPTSQAQIVQGITPQTIHGVQASGQN* |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | SP3 (NP_003102, 287 a.a. ~ 430 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 6670 |
| Clone Number | 4E5 |
| Iso type | IgG2a Kappa |
More info
Mouse monoclonal antibody raised against a full length recombinant SP3.