Ver mas grande
SNX1 monoclonal antibody (M01), clone 6H1
AB-H00006642-M01
Producto nuevo
SNX1 monoclonal antibody (M01), clone 6H1
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | SNX1 |
| Gene Alias | HsT17379|MGC8664|SNX1A|Vps5 |
| Gene Description | sorting nexin 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,RNAi-Ab |
| Immunogen Prot. Seq | KVTTQTSLPLFRSKQFAVKRRFSDFLGLYEKLSEKHSQNGFIVPPPPEKSLIGMTKVKVGKEDSSSAEFLEKRRAALERYLQRIVNHPTMLQDPDVREFLEKEELPRAVG |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | SNX1 (NP_003090, 166 a.a. ~ 275 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 6642 |
| Clone Number | 6H1 |
| Iso type | IgG2a Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant SNX1.