SNX1 monoclonal antibody (M01), clone 6H1 View larger

Mouse monoclonal antibody raised against a partial recombinant SNX1.

AB-H00006642-M01

New product

SNX1 monoclonal antibody (M01), clone 6H1

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name SNX1
Gene Alias HsT17379|MGC8664|SNX1A|Vps5
Gene Description sorting nexin 1
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq KVTTQTSLPLFRSKQFAVKRRFSDFLGLYEKLSEKHSQNGFIVPPPPEKSLIGMTKVKVGKEDSSSAEFLEKRRAALERYLQRIVNHPTMLQDPDVREFLEKEELPRAVG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SNX1 (NP_003090, 166 a.a. ~ 275 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6642
Clone Number 6H1
Iso type IgG2a Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant SNX1.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant SNX1.

Mouse monoclonal antibody raised against a partial recombinant SNX1.