SNX1 monoclonal antibody (M01), clone 6H1
  • SNX1 monoclonal antibody (M01), clone 6H1

SNX1 monoclonal antibody (M01), clone 6H1

Ref: AB-H00006642-M01
SNX1 monoclonal antibody (M01), clone 6H1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SNX1.
Información adicional
Size 100 ug
Gene Name SNX1
Gene Alias HsT17379|MGC8664|SNX1A|Vps5
Gene Description sorting nexin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq KVTTQTSLPLFRSKQFAVKRRFSDFLGLYEKLSEKHSQNGFIVPPPPEKSLIGMTKVKVGKEDSSSAEFLEKRRAALERYLQRIVNHPTMLQDPDVREFLEKEELPRAVG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SNX1 (NP_003090, 166 a.a. ~ 275 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6642
Clone Number 6H1
Iso type IgG2a Kappa

Enviar uma mensagem


SNX1 monoclonal antibody (M01), clone 6H1

SNX1 monoclonal antibody (M01), clone 6H1