SMO monoclonal antibody (M11), clone 1D9 Ver mas grande

SMO monoclonal antibody (M11), clone 1D9

AB-H00006608-M11

Producto nuevo

SMO monoclonal antibody (M11), clone 1D9

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 100 ug
Gene Name SMO
Gene Alias Gx|SMOH
Gene Description smoothened homolog (Drosophila)
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq NLWLVEAEISPELQKRLGRKKKRRKRKKEVCPLAPPPELHPPAPAPSTIPRLPQLPRQKCLVAAGAWGAGDSCRQGAWTLVSNPFCPEPSPPQDPFLPSAPAPVAWAHGRRQGLGPIHSRTNLMDTELMDADSDF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SMO (NP_005622.1, 653 a.a. ~ 787 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6608
Clone Number 1D9
Iso type IgG2a Kappa

Más información

Mouse monoclonal antibody raised against a full-length recombinant SMO.

Consulta sobre un producto

SMO monoclonal antibody (M11), clone 1D9

SMO monoclonal antibody (M11), clone 1D9