SMO monoclonal antibody (M11), clone 1D9 View larger

Mouse monoclonal antibody raised against a full-length recombinant SMO.

AB-H00006608-M11

New product

SMO monoclonal antibody (M11), clone 1D9

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name SMO
Gene Alias Gx|SMOH
Gene Description smoothened homolog (Drosophila)
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq NLWLVEAEISPELQKRLGRKKKRRKRKKEVCPLAPPPELHPPAPAPSTIPRLPQLPRQKCLVAAGAWGAGDSCRQGAWTLVSNPFCPEPSPPQDPFLPSAPAPVAWAHGRRQGLGPIHSRTNLMDTELMDADSDF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SMO (NP_005622.1, 653 a.a. ~ 787 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6608
Clone Number 1D9
Iso type IgG2a Kappa

More info

Mouse monoclonal antibody raised against a full-length recombinant SMO.

Enviar uma mensagem

Mouse monoclonal antibody raised against a full-length recombinant SMO.

Mouse monoclonal antibody raised against a full-length recombinant SMO.