Ver mas grande
SLC12A2 monoclonal antibody (M01), clone 5H7
AB-H00006558-M01
Producto nuevo
SLC12A2 monoclonal antibody (M01), clone 5H7
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | SLC12A2 |
| Gene Alias | BSC|BSC2|MGC104233|NKCC1 |
| Gene Description | solute carrier family 12 (sodium/potassium/chloride transporters), member 2 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA,IF |
| Immunogen Prot. Seq | YINLFHDAFDIQYGVVVIRLKEGLDISHLQGQEELLSSQEKSPGTKDVVVSVEYSKKSDLDTSKPLSEKPITHKVEEEDGKTATQPLLKKESKGPIVPLNVADQKLLE |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | SLC12A2 (NP_001037.1, 903 a.a. ~ 1010 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 6558 |
| Clone Number | 5H7 |
| Iso type | IgG2b Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant SLC12A2.