SLC12A2 monoclonal antibody (M01), clone 5H7
  • SLC12A2 monoclonal antibody (M01), clone 5H7

SLC12A2 monoclonal antibody (M01), clone 5H7

Ref: AB-H00006558-M01
SLC12A2 monoclonal antibody (M01), clone 5H7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SLC12A2.
Información adicional
Size 100 ug
Gene Name SLC12A2
Gene Alias BSC|BSC2|MGC104233|NKCC1
Gene Description solute carrier family 12 (sodium/potassium/chloride transporters), member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,IF
Immunogen Prot. Seq YINLFHDAFDIQYGVVVIRLKEGLDISHLQGQEELLSSQEKSPGTKDVVVSVEYSKKSDLDTSKPLSEKPITHKVEEEDGKTATQPLLKKESKGPIVPLNVADQKLLE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC12A2 (NP_001037.1, 903 a.a. ~ 1010 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6558
Clone Number 5H7
Iso type IgG2b Kappa

Enviar uma mensagem


SLC12A2 monoclonal antibody (M01), clone 5H7

SLC12A2 monoclonal antibody (M01), clone 5H7