SLC12A2 monoclonal antibody (M01), clone 5H7 View larger

Mouse monoclonal antibody raised against a partial recombinant SLC12A2.

AB-H00006558-M01

New product

SLC12A2 monoclonal antibody (M01), clone 5H7

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name SLC12A2
Gene Alias BSC|BSC2|MGC104233|NKCC1
Gene Description solute carrier family 12 (sodium/potassium/chloride transporters), member 2
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,IF
Immunogen Prot. Seq YINLFHDAFDIQYGVVVIRLKEGLDISHLQGQEELLSSQEKSPGTKDVVVSVEYSKKSDLDTSKPLSEKPITHKVEEEDGKTATQPLLKKESKGPIVPLNVADQKLLE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC12A2 (NP_001037.1, 903 a.a. ~ 1010 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6558
Clone Number 5H7
Iso type IgG2b Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant SLC12A2.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant SLC12A2.

Mouse monoclonal antibody raised against a partial recombinant SLC12A2.