Ver mas grande
SLC12A1 monoclonal antibody (M03), clone 4H4
AB-H00006557-M03
Producto nuevo
SLC12A1 monoclonal antibody (M03), clone 4H4
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | SLC12A1 |
| Gene Alias | BSC1|MGC48843|NKCC2 |
| Gene Description | solute carrier family 12 (sodium/potassium/chloride transporters), member 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,WB-Re,ELISA |
| Immunogen Prot. Seq | AKTDASFHAYDSHTNTYYLQTFGHNTMDAVPKIEYYRNTGSISGPKVNRPSLLEIHEQLAKNVAVTPSSADRVANGDGIPGDEQAENKEDDQA |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | SLC12A1 (NP_000329.1, 80 a.a. ~ 172 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 6557 |
| Clone Number | 4H4 |
| Iso type | IgG2a Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant SLC12A1.