SLC12A1 monoclonal antibody (M03), clone 4H4
  • SLC12A1 monoclonal antibody (M03), clone 4H4

SLC12A1 monoclonal antibody (M03), clone 4H4

Ref: AB-H00006557-M03
SLC12A1 monoclonal antibody (M03), clone 4H4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SLC12A1.
Información adicional
Size 100 ug
Gene Name SLC12A1
Gene Alias BSC1|MGC48843|NKCC2
Gene Description solute carrier family 12 (sodium/potassium/chloride transporters), member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq AKTDASFHAYDSHTNTYYLQTFGHNTMDAVPKIEYYRNTGSISGPKVNRPSLLEIHEQLAKNVAVTPSSADRVANGDGIPGDEQAENKEDDQA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC12A1 (NP_000329.1, 80 a.a. ~ 172 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6557
Clone Number 4H4
Iso type IgG2a Kappa

Enviar uma mensagem


SLC12A1 monoclonal antibody (M03), clone 4H4

SLC12A1 monoclonal antibody (M03), clone 4H4