CXCL5 polyclonal antibody (A01) Ver mas grande

CXCL5 polyclonal antibody (A01)

AB-H00006374-A01

Producto nuevo

CXCL5 polyclonal antibody (A01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 50 uL
Gene Name CXCL5
Gene Alias ENA-78|SCYB5
Gene Description chemokine (C-X-C motif) ligand 5
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLRKVIQKILDGGNKEN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CXCL5 (AAH08376, 1 a.a. ~ 114 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6374

Más información

Mouse polyclonal antibody raised against a full-length recombinant CXCL5.

Consulta sobre un producto

CXCL5 polyclonal antibody (A01)

CXCL5 polyclonal antibody (A01)