CXCL5 polyclonal antibody (A01)
  • CXCL5 polyclonal antibody (A01)

CXCL5 polyclonal antibody (A01)

Ref: AB-H00006374-A01
CXCL5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant CXCL5.
Información adicional
Size 50 uL
Gene Name CXCL5
Gene Alias ENA-78|SCYB5
Gene Description chemokine (C-X-C motif) ligand 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLRKVIQKILDGGNKEN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CXCL5 (AAH08376, 1 a.a. ~ 114 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6374

Enviar uma mensagem


CXCL5 polyclonal antibody (A01)

CXCL5 polyclonal antibody (A01)