CXCL5 polyclonal antibody (A01) View larger

Mouse polyclonal antibody raised against a full-length recombinant CXCL5.

AB-H00006374-A01

New product

CXCL5 polyclonal antibody (A01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 50 uL
Gene Name CXCL5
Gene Alias ENA-78|SCYB5
Gene Description chemokine (C-X-C motif) ligand 5
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLRKVIQKILDGGNKEN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CXCL5 (AAH08376, 1 a.a. ~ 114 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6374

More info

Mouse polyclonal antibody raised against a full-length recombinant CXCL5.

Enviar uma mensagem

Mouse polyclonal antibody raised against a full-length recombinant CXCL5.

Mouse polyclonal antibody raised against a full-length recombinant CXCL5.