AB-H00005583-B02P
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Size | 50 ug |
Gene Name | PRKCH |
Gene Alias | MGC26269|MGC5363|PKC-L|PKCL|PRKCL|nPKC-eta |
Gene Description | protein kinase C, eta |
Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
Application Key | WB-Tr |
Immunogen Prot. Seq | MSSGTMKFNGYLRVRIGEAVGLQPTRWSLRHSLFKKGHQLLDPYLTVSVDQVRVGQTSTKQKTNKPTYNEEFCANVTDGGHLELAVFHETPLGYDHFVANCTLQFQELLRTTGASDTFEGWVDLEPEGKVFVVITLTGSFTEATLQRDRIFKHFTRKRQRAMRRRVHQINGHKFMATYLRQPTYCSHCREFIWGVFGKQGYQCQVCTCVVHKRCHHLIVTACTCQNNINKVDSKIAEQRFGINIPHKFSIHNYKV |
Antigen species Target species | Human |
Quality control testing | Antibody reactive against mammalian transfected lysate. |
Immunogen | PRKCH (NP_006246.2, 1 a.a. ~ 683 a.a) full-length human protein. |
Storage Buffer | In 1x PBS, pH 7.4 |
Gene ID | 5583 |