PRKCH purified MaxPab mouse polyclonal antibody (B02P) View larger

Mouse polyclonal antibody raised against a full-length human PRKCH protein.

AB-H00005583-B02P

New product

PRKCH purified MaxPab mouse polyclonal antibody (B02P)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 50 ug
Gene Name PRKCH
Gene Alias MGC26269|MGC5363|PKC-L|PKCL|PRKCL|nPKC-eta
Gene Description protein kinase C, eta
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSSGTMKFNGYLRVRIGEAVGLQPTRWSLRHSLFKKGHQLLDPYLTVSVDQVRVGQTSTKQKTNKPTYNEEFCANVTDGGHLELAVFHETPLGYDHFVANCTLQFQELLRTTGASDTFEGWVDLEPEGKVFVVITLTGSFTEATLQRDRIFKHFTRKRQRAMRRRVHQINGHKFMATYLRQPTYCSHCREFIWGVFGKQGYQCQVCTCVVHKRCHHLIVTACTCQNNINKVDSKIAEQRFGINIPHKFSIHNYKV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PRKCH (NP_006246.2, 1 a.a. ~ 683 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5583

More info

Mouse polyclonal antibody raised against a full-length human PRKCH protein.

Enviar uma mensagem

Mouse polyclonal antibody raised against a full-length human PRKCH protein.

Mouse polyclonal antibody raised against a full-length human PRKCH protein.