Ver mas grande
PAK1 monoclonal antibody (M01), clone 1E11
AB-H00005058-M01
Producto nuevo
PAK1 monoclonal antibody (M01), clone 1E11
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | PAK1 |
| Gene Alias | MGC130000|MGC130001|PAKalpha |
| Gene Description | p21 protein (Cdc42/Rac)-activated kinase 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,IHC-P,S-ELISA,ELISA |
| Immunogen Prot. Seq | APRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGA |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | PAK1 (NP_002567, 191 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 5058 |
| Clone Number | 1E11 |
| Iso type | IgG1 kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant PAK1.