PAK1 monoclonal antibody (M01), clone 1E11
  • PAK1 monoclonal antibody (M01), clone 1E11

PAK1 monoclonal antibody (M01), clone 1E11

Ref: AB-H00005058-M01
PAK1 monoclonal antibody (M01), clone 1E11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PAK1.
Información adicional
Size 100 ug
Gene Name PAK1
Gene Alias MGC130000|MGC130001|PAKalpha
Gene Description p21 protein (Cdc42/Rac)-activated kinase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq APRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PAK1 (NP_002567, 191 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5058
Clone Number 1E11
Iso type IgG1 kappa

Enviar uma mensagem


PAK1 monoclonal antibody (M01), clone 1E11

PAK1 monoclonal antibody (M01), clone 1E11