PAK1 monoclonal antibody (M01), clone 1E11 View larger

Mouse monoclonal antibody raised against a partial recombinant PAK1.

AB-H00005058-M01

New product

PAK1 monoclonal antibody (M01), clone 1E11

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name PAK1
Gene Alias MGC130000|MGC130001|PAKalpha
Gene Description p21 protein (Cdc42/Rac)-activated kinase 1
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq APRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PAK1 (NP_002567, 191 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5058
Clone Number 1E11
Iso type IgG1 kappa

More info

Mouse monoclonal antibody raised against a partial recombinant PAK1.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant PAK1.

Mouse monoclonal antibody raised against a partial recombinant PAK1.