ROR1 monoclonal antibody (M02), clone 1B4 Ver mas grande

ROR1 monoclonal antibody (M02), clone 1B4

AB-H00004919-M02

Producto nuevo

ROR1 monoclonal antibody (M02), clone 1B4

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 100 ug
Gene Name ROR1
Gene Alias MGC99659|NTRKR1|dJ537F10.1
Gene Description receptor tyrosine kinase-like orphan receptor 1
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq ANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACGK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ROR1 (-, 294 a.a. ~ 393 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4919
Clone Number 1B4
Iso type IgG1 Kappa

Más información

Mouse monoclonal antibody raised against a partial recombinant ROR1.

Consulta sobre un producto

ROR1 monoclonal antibody (M02), clone 1B4

ROR1 monoclonal antibody (M02), clone 1B4