ROR1 monoclonal antibody (M02), clone 1B4 View larger

Mouse monoclonal antibody raised against a partial recombinant ROR1.

AB-H00004919-M02

New product

ROR1 monoclonal antibody (M02), clone 1B4

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name ROR1
Gene Alias MGC99659|NTRKR1|dJ537F10.1
Gene Description receptor tyrosine kinase-like orphan receptor 1
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq ANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACGK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ROR1 (-, 294 a.a. ~ 393 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4919
Clone Number 1B4
Iso type IgG1 Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant ROR1.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant ROR1.

Mouse monoclonal antibody raised against a partial recombinant ROR1.