NEK2 purified MaxPab mouse polyclonal antibody (B01P) Ver mas grande

NEK2 purified MaxPab mouse polyclonal antibody (B01P)

AB-H00004751-B01P

Producto nuevo

NEK2 purified MaxPab mouse polyclonal antibody (B01P)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 50 ug
Gene Name NEK2
Gene Alias HsPK21|NEK2A|NLK1
Gene Description NIMA (never in mitosis gene a)-related kinase 2
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGHTVLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFAKTFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NEK2 (NP_002488.1, 1 a.a. ~ 445 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4751

Más información

Mouse polyclonal antibody raised against a full-length human NEK2 protein.

Consulta sobre un producto

NEK2 purified MaxPab mouse polyclonal antibody (B01P)

NEK2 purified MaxPab mouse polyclonal antibody (B01P)