NEK2 purified MaxPab mouse polyclonal antibody (B01P)
  • NEK2 purified MaxPab mouse polyclonal antibody (B01P)

NEK2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004751-B01P
NEK2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NEK2 protein.
Información adicional
Size 50 ug
Gene Name NEK2
Gene Alias HsPK21|NEK2A|NLK1
Gene Description NIMA (never in mitosis gene a)-related kinase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGHTVLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFAKTFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NEK2 (NP_002488.1, 1 a.a. ~ 445 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4751

Enviar uma mensagem


NEK2 purified MaxPab mouse polyclonal antibody (B01P)

NEK2 purified MaxPab mouse polyclonal antibody (B01P)