Ver mas grande
LY9 polyclonal antibody (A01)
AB-H00004063-A01
Producto nuevo
LY9 polyclonal antibody (A01)
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 uL |
| Gene Name | LY9 |
| Gene Alias | CD229|SLAMF3|hly9|mLY9 |
| Gene Description | lymphocyte antigen 9 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | EPQVTMKSVKVSENFSCNITLMCSVKGAEKSVLYSWTPREPHASESNGGSILTVSRTPCDPDLPYICTAQNPVSQRSSLPVHVGQFCTDPGASRGGTT |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | LY9 (NP_002339, 156 a.a. ~ 253 a.a) partial recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 4063 |
Más información
Mouse polyclonal antibody raised against a partial recombinant LY9.