LY9 polyclonal antibody (A01)
  • LY9 polyclonal antibody (A01)

LY9 polyclonal antibody (A01)

Ref: AB-H00004063-A01
LY9 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant LY9.
Información adicional
Size 50 uL
Gene Name LY9
Gene Alias CD229|SLAMF3|hly9|mLY9
Gene Description lymphocyte antigen 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EPQVTMKSVKVSENFSCNITLMCSVKGAEKSVLYSWTPREPHASESNGGSILTVSRTPCDPDLPYICTAQNPVSQRSSLPVHVGQFCTDPGASRGGTT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LY9 (NP_002339, 156 a.a. ~ 253 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4063

Enviar uma mensagem


LY9 polyclonal antibody (A01)

LY9 polyclonal antibody (A01)