CYP4F3 polyclonal antibody (A01)
  • CYP4F3 polyclonal antibody (A01)

CYP4F3 polyclonal antibody (A01)

Ref: AB-H00004051-A01
CYP4F3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CYP4F3.
Información adicional
Size 50 uL
Gene Name CYP4F3
Gene Alias CPF3|CYP4F|LTB4H
Gene Description cytochrome P450, family 4, subfamily F, polypeptide 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq RIFHPTYIKPVLFAPAAIVPKDKVFYSFLKPWLGDGLLLSAGEKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQLLASEGSARLDMFEHISLM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CYP4F3 (NP_000887, 100 a.a. ~ 198 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4051

Enviar un mensaje


CYP4F3 polyclonal antibody (A01)

CYP4F3 polyclonal antibody (A01)