CYP4F3 polyclonal antibody (A01) View larger

Mouse polyclonal antibody raised against a partial recombinant CYP4F3.

AB-H00004051-A01

New product

CYP4F3 polyclonal antibody (A01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 50 uL
Gene Name CYP4F3
Gene Alias CPF3|CYP4F|LTB4H
Gene Description cytochrome P450, family 4, subfamily F, polypeptide 3
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq RIFHPTYIKPVLFAPAAIVPKDKVFYSFLKPWLGDGLLLSAGEKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQLLASEGSARLDMFEHISLM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CYP4F3 (NP_000887, 100 a.a. ~ 198 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4051

More info

Mouse polyclonal antibody raised against a partial recombinant CYP4F3.

Enviar uma mensagem

Mouse polyclonal antibody raised against a partial recombinant CYP4F3.

Mouse polyclonal antibody raised against a partial recombinant CYP4F3.