Ver mas grande
KCNJ10 polyclonal antibody (A01)
AB-H00003766-A01
Producto nuevo
KCNJ10 polyclonal antibody (A01)
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 uL |
| Gene Name | KCNJ10 |
| Gene Alias | BIRK-10|KCNJ13-PEN|KIR1.2|KIR4.1 |
| Gene Description | potassium inwardly-rectifying channel, subfamily J, member 10 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | DFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | KCNJ10 (NP_002232, 276 a.a. ~ 379 a.a) partial recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 3766 |
Más información
Mouse polyclonal antibody raised against a partial recombinant KCNJ10.