KCNJ10 polyclonal antibody (A01)
  • KCNJ10 polyclonal antibody (A01)

KCNJ10 polyclonal antibody (A01)

Ref: AB-H00003766-A01
KCNJ10 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant KCNJ10.
Información adicional
Size 50 uL
Gene Name KCNJ10
Gene Alias BIRK-10|KCNJ13-PEN|KIR1.2|KIR4.1
Gene Description potassium inwardly-rectifying channel, subfamily J, member 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KCNJ10 (NP_002232, 276 a.a. ~ 379 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3766

Enviar un mensaje


KCNJ10 polyclonal antibody (A01)

KCNJ10 polyclonal antibody (A01)