View larger
Mouse polyclonal antibody raised against a partial recombinant KCNJ10.
AB-H00003766-A01
New product
KCNJ10 polyclonal antibody (A01)
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 50 uL |
| Gene Name | KCNJ10 |
| Gene Alias | BIRK-10|KCNJ13-PEN|KIR1.2|KIR4.1 |
| Gene Description | potassium inwardly-rectifying channel, subfamily J, member 10 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | DFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | KCNJ10 (NP_002232, 276 a.a. ~ 379 a.a) partial recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 3766 |
More info
Mouse polyclonal antibody raised against a partial recombinant KCNJ10.