Ver mas grande
ING1 monoclonal antibody (M05), clone 2F9
AB-H00003621-M05
Producto nuevo
ING1 monoclonal antibody (M05), clone 2F9
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | ING1 |
| Gene Alias | p24ING1c|p33|p33ING1|p33ING1b|p47|p47ING1a |
| Gene Description | inhibitor of growth family, member 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Re,S-ELISA,ELISA |
| Immunogen Prot. Seq | DAKYQEILKELDECYERFSRETDGAQKRRMLHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGEAAA |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | ING1 (NP_937862.1, 41 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 3621 |
| Clone Number | 2F9 |
| Iso type | IgM Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant ING1.