ING1 monoclonal antibody (M05), clone 2F9 View larger

Mouse monoclonal antibody raised against a partial recombinant ING1.

AB-H00003621-M05

New product

ING1 monoclonal antibody (M05), clone 2F9

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 50 ug
Gene Name ING1
Gene Alias p24ING1c|p33|p33ING1|p33ING1b|p47|p47ING1a
Gene Description inhibitor of growth family, member 1
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq DAKYQEILKELDECYERFSRETDGAQKRRMLHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGEAAA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ING1 (NP_937862.1, 41 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3621
Clone Number 2F9
Iso type IgM Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant ING1.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant ING1.

Mouse monoclonal antibody raised against a partial recombinant ING1.