ING1 monoclonal antibody (M05), clone 2F9
  • ING1 monoclonal antibody (M05), clone 2F9

ING1 monoclonal antibody (M05), clone 2F9

Ref: AB-H00003621-M05
ING1 monoclonal antibody (M05), clone 2F9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ING1.
Información adicional
Size 50 ug
Gene Name ING1
Gene Alias p24ING1c|p33|p33ING1|p33ING1b|p47|p47ING1a
Gene Description inhibitor of growth family, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq DAKYQEILKELDECYERFSRETDGAQKRRMLHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGEAAA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ING1 (NP_937862.1, 41 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3621
Clone Number 2F9
Iso type IgM Kappa

Enviar uma mensagem


ING1 monoclonal antibody (M05), clone 2F9

ING1 monoclonal antibody (M05), clone 2F9