IL8 monoclonal antibody (M07), clone 4G10 Ver mas grande

IL8 monoclonal antibody (M07), clone 4G10

AB-H00003576-M07

Producto nuevo

IL8 monoclonal antibody (M07), clone 4G10

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 100 ug
Gene Name IL8
Gene Alias CXCL8|GCP-1|GCP1|LECT|LUCT|LYNAP|MDNCF|MONAP|NAF|NAP-1|NAP1
Gene Description interleukin 8
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL8 (AAH13615.1, 21 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3576
Clone Number 4G10
Iso type IgG2a Kappa

Más información

Mouse monoclonal antibody raised against a partial recombinant IL8.

Consulta sobre un producto

IL8 monoclonal antibody (M07), clone 4G10

IL8 monoclonal antibody (M07), clone 4G10