IL8 monoclonal antibody (M07), clone 4G10 View larger

Mouse monoclonal antibody raised against a partial recombinant IL8.

AB-H00003576-M07

New product

IL8 monoclonal antibody (M07), clone 4G10

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name IL8
Gene Alias CXCL8|GCP-1|GCP1|LECT|LUCT|LYNAP|MDNCF|MONAP|NAF|NAP-1|NAP1
Gene Description interleukin 8
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL8 (AAH13615.1, 21 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3576
Clone Number 4G10
Iso type IgG2a Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant IL8.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant IL8.

Mouse monoclonal antibody raised against a partial recombinant IL8.